General Information

  • ID:  hor002092
  • Uniprot ID:  Q9TRM8
  • Protein name:  Relaxin B chain
  • Gene name:  RLN
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Placenta; syncytiotrophoblast.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRE
  • Length:  35(26-60)
  • Propeptide:  MLRWFLSHLLGVWLLLSQLPREIPATDDKKLKACGRDYVRLQIEVCGSIWWGRKAGQLRERRQISEPLAEVVPSSIINDPEILSLMLQSIPGMPQELRIATRSGKEKLLRELHFVLEDSNLNLEEMKKTFLNTQFEAEDKSLSKLDKHPRKKRDNYIKMSDKCCNVGCTRRELASRC
  • Signal peptide:  MLRWFLSHLLGVWLLLSQLPREIPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2
  • Target Unid:   Q5XM32
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9TRM8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002092_AF2.pdbhor002092_ESM.pdb

Physical Information

Mass: 468637 Formula: C178H289N55O51S2
Absent amino acids: FHMNP Common amino acids: GKR
pI: 9.43 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 11
Hydrophobicity: -76.86 Boman Index: -9157
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 78
Instability Index: 3940 Extinction Coefficient cystines: 12615
Absorbance 280nm: 371.03

Literature

  • PubMed ID:  1388669
  • Title:  Purification and sequence determination of canine relaxin.